PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.2KG563300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family bZIP
Protein Properties Length: 575aa    MW: 60842.9 Da    PI: 6.2065
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.2KG563300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.21e-14115174362
                          XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                          e kr  r+ +NRe+A  sRqRKk+++eeLe kvk+++a   +L  +++  + e a lk++
  Pavir.2KG563300.1.p 115 EAKRRARLVRNRESAHLSRQRKKQYVEELEGKVKAMQATIADLSATISCVTAENAVLKQQ 174
                          78*************************************************999999997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.5E-13112177IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.806115175IPR004827Basic-leucine zipper domain
PfamPF001703.8E-13115175IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.2E-17117175No hitNo description
SuperFamilySSF579593.38E-13117175No hitNo description
CDDcd147045.54E-21118169No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 575 aa     Download sequence    Send to blast
MAEPTLLAPD PFGDISFPEF QAPADVDNFV FEDFDLEDLD LDVDFDLDPF ASDGLLAQPP  60
PLATSSSSAG SPEGGSSSSG AGGDGGLRNE ESSESFSRSA SGTGGSGKGK REDDEAKRRA  120
RLVRNRESAH LSRQRKKQYV EELEGKVKAM QATIADLSAT ISCVTAENAV LKQQLGGAAG  180
TAPPPPPPPP PLPMYPAVYP LPMPWMHPAY AMRGSQVPLV PIPRLKPQQP APATAEPPAK  240
KARKTKKVAS VSLLGLLCLV MLCGCLIPAV NRMYGSVDGG EGAAFGPSHH GRVLAVEGPR  300
DTVSDSIDPK LPQGTSETLP ALLYLPKNGK HVKINGNLVI KSIVASEKAS LQMSGYDGKS  360
PRNQGKEETS LAIPGYVAPL EAGDVMESTT GMKNKLMALA PADGNMYRED DGLLPQWFSE  420
AMSGPLPSSG MCTEVFQFDV SPSTAHANGI VPVYSNAMSN STQNFTENLP SAHPHTVKNR  480
RISYSEAIPL KGSTSNNTER LKTPPKNESF GSMKPVSSVV VSVLADPREA GEGNGEGRIS  540
SKSLSRIFVV VLIDSVKYVT YSCVLPFKNH SPHL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.158560.0callus| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002461117.10.0hypothetical protein SORBIDRAFT_02g041070
TrEMBLC5X3Z40.0C5X3Z4_SORBI; Putative uncharacterized protein Sb02g041070
STRINGSb02g041070.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP111793035
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.13e-71bZIP family protein